DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and iotaTry

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:226 Identity:102/226 - (45%)
Similarity:148/226 - (65%) Gaps:3/226 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSG 93
            |||:|||...|.:.|||:|:|.|..|.|||.|||..:|:||.|||...|.:::::|.|:...:.|
  Fly    26 GRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNYG 90

  Fly    94 GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSY 158
            |....|:::|.||.:::..:..|||:::::..|||..:.:||.|||::|:.|...:|:|||....
  Fly    91 GTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGWGHTDN 155

  Fly   159 GSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ-IRSTMICAAASGKDACQGDSGGPLVSGGVLVG 222
            |:.|  ..||...:.|:.:.:|||..:|||:. :....||||::..|||.||||||||:...|||
  Fly   156 GALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDADACTGDSGGPLVASSQLVG 218

  Fly   223 VVSWGYGCAYSNYPGVYADVAALRSWVISNA 253
            :|||||.||..||||||||||.||.|::..|
  Fly   219 IVSWGYRCADDNYPGVYADVAILRPWIVKAA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 99/219 (45%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 99/219 (45%)
Tryp_SPc 28..247 CDD:238113 99/220 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443170
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm49678
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.900

Return to query results.
Submit another query.