DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and thetaTry

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:118/257 - (45%)
Similarity:159/257 - (61%) Gaps:6/257 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILL--SAVACALGGT--VPEGLLPQLDGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSI 60
            |.:.|:||  .||..|..||  |..|...:.:||||||..|||.:.|:|:||| :||||.||||:
  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65

  Fly    61 YSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGA 125
            .:.:.:|||||||.....|.:.:|.||:.::.||:..:|.....:|.||:.||..|:.|:|::..
  Fly    66 INEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEK 130

  Fly   126 LTFSSTIKAIGLASSNPANGAAASVSGWGTLSY-GSSSIPSQLQYVNVNIVSQSQCASSTYGYGS 189
            :..:..|:.|.||:..|..|..|.|:|||:..| ...::|..||.|.||||....|||..|.||.
  Fly   131 VKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGE 195

  Fly   190 QIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            .|..:|:||....||||||||||||..|..|||:|||||.||.:..||||:||.|||.|:::
  Fly   196 IIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 105/220 (48%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 105/220 (48%)
Tryp_SPc 35..255 CDD:238113 104/219 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.850

Return to query results.
Submit another query.