DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG1773

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:274 Identity:76/274 - (27%)
Similarity:109/274 - (39%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VPEGLLP--QLDGRIVGGSATTISSFPWQISLQRSGSHS---CGGSIYSSNVIVTAAHCLQSVSA 78
            |...|:|  :|..||.||..:::.|.||...|..||...   ||||:.|...::|||||.:....
  Fly    48 VLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPR 112

  Fly    79 SVLQIRAGSSYW--------SSGGVT-------------FSVSSFKNHEGYNANTMVNDIAIIKI 122
            | .:||.    |        :|..||             |::..:..||.:|......|||:||:
  Fly   113 S-KEIRV----WLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKL 172

  Fly   123 NGALTFSSTIKAIGLASSNP------ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCA 181
            |..:.|...|:.|.|..::.      ..|.:....|||...  |....:....|::|   ..:|.
  Fly   173 NKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTE--SRRFANSTMEVHIN---TEKCT 232

  Fly   182 SSTYGYGSQIRST-MICAAASGKDACQGDSGGPLV--------SGGVLVGVVSWGYGCAYSNYPG 237
            ..        |.| .:||.....|.|.|||||||:        :..|..||||.|.....:....
  Fly   233 DG--------RDTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKA 289

  Fly   238 VYADVAALRSWVIS 251
            .|.||.....|:::
  Fly   290 YYMDVPTYVPWILA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 71/257 (28%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 71/257 (28%)
Tryp_SPc 62..301 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.