DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG8170

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:236 Identity:82/236 - (34%)
Similarity:108/236 - (45%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSG- 93
            |||||......|||||..: |.||..||||:.|...:|||.||:...:...:.:..|....:|. 
  Fly   611 RIVGGDDAGFGSFPWQAYI-RIGSSRCGGSLISRRHVVTAGHCVARATPRQVHVTLGDYVINSAV 674

  Fly    94 ----GVTFSVSSFKNHEGYNANTMVN--DIAIIKINGALTFSSTIKAIGLASSN-PANGAAASVS 151
                ..||.|.....|..:......:  ||:::.:...:.|...|..|.|...| ...|.....:
  Fly   675 EPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFLGKFGWAA 739

  Fly   152 GWGTLSYGSSSIPSQLQYVNVNIVSQSQCA--SSTYGYGSQIRSTMICAA--ASGKDACQGDSGG 212
            |||.|:.||...|..||.|:|.::....|.  ....|....|...|:||.  ..|||:|||||||
  Fly   740 GWGALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGG 804

  Fly   213 PLV--SGG--VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||:  ..|  .|:||||.||.||....||:|..|:....||
  Fly   805 PLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/234 (34%)
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 80/234 (34%)
Tryp_SPc 612..846 CDD:238113 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
11.000

Return to query results.
Submit another query.