DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG13744

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:113/260 - (43%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQI 83
            ||......|..||:||.....:.:|||..: |...:.|||.:.|:|::.|||||:|....:.:.:
  Fly   130 VPRTAQNTLQKRIIGGRPAQFAEYPWQAHI-RIAEYQCGGVLISANMVATAAHCIQQAHLADITV 193

  Fly    84 RAGSSYWSSGGVTFSVSSFKNH------------------EGYNANTMVNDIAIIKINGALTFSS 130
            ..|.......|........:.|                  :.|       |||::|:....:|:.
  Fly   194 YLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRY-------DIALLKLAQPTSFTE 251

  Fly   131 TIKAIGLASSNPAN--GAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCA--SSTYGYGSQ 190
            .|..|.| ...|..  |....::||| |.::...:..:.||..:|.|::...|.  ..:.....:
  Fly   252 HILPICL-PQYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVE 315

  Fly   191 IRSTMICAAASG--KDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |::.|.||..|.  .|||.||||||||    ...||||:.|.|:||...:.||:|.:|.....|:
  Fly   316 IKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWI 380

  Fly   250  249
              Fly   381  380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 70/247 (28%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 70/247 (28%)
Tryp_SPc 142..383 CDD:238113 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.