DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Np

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:241 Identity:84/241 - (34%)
Similarity:121/241 - (50%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQ--RSGS--HSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90
            |||||:......:||||||:  |:.:  |.||.::.:.|..:|||||:.:|..|.|.:|.|....
  Fly   797 RIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDL 861

  Fly    91 SS-----GGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPAN--GAAA 148
            :.     |.....|....:|..::..|...|:|:::....:.|...|..: ....|..|  |..|
  Fly   862 AEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPV-CVPDNDENFIGQTA 925

  Fly   149 SVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCAS--STYGYGSQIRSTMICAA--ASGKDACQGD 209
            .|:|||.| |....:||.||.|.|.:::.:.|.|  .:.||...|....|||.  ..|.|:|:||
  Fly   926 FVTGWGRL-YEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGD 989

  Fly   210 SGGPLV------SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||:|      ....|.||:|||.|||.:|.||||..::..|.|:
  Fly   990 SGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/239 (35%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 83/239 (35%)
Tryp_SPc 798..1038 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.