DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and flz

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:251 Identity:87/251 - (34%)
Similarity:129/251 - (51%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLLPQL-DGRIVGGSATTISSFPWQISLQRS------GSHSCGGSIYSSNVIVTAAHCLQSVSAS 79
            |:.|.: .||||||..:|..::|||:.::.|      ..:.|||.:.:|..::|||||.....||
  Fly  1439 GVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLAS 1503

  Fly    80 VLQIRA----GSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASS 140
            ::.:..    .....|...||.:|.....|..|:..|..||:|:::::..:.|.:.|..|.:.:.
  Fly  1504 LVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPND 1568

  Fly   141 -NPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCAS--STYGYGSQIRSTMICAA-AS 201
             ....|..|:|:|||.|.|| ..:||.||.|.|.|:..|.|..  .|.|:..:|.::.:||. |:
  Fly  1569 VADFTGRMATVTGWGRLKYG-GGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYAN 1632

  Fly   202 G-KDACQGDSGGPLV----SGGV-LVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            | ||:|:||||||||    .|.. |.|.||.|..||....||||......:.|:.|
  Fly  1633 GQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRS 1688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 82/238 (34%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 83/241 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.