DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and scaf

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:249 Identity:61/249 - (24%)
Similarity:106/249 - (42%) Gaps:60/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVACALGG--TVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHS--CGGSIYSSNVIVTAA 70
            |..||...  |.|.| :..||        ...:..|||..:.|..|.:  |||:|.....::::|
  Fly   409 AGVCATRNKRTKPTG-VKDLD--------ANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSA 464

  Fly    71 HCLQSVSASVLQIRAGSSYWSSGG----VTFSVSSFKN---HEGYNANTMVNDIAIIKINGALTF 128
            .|:..:..:.::::||.  |..|.    :.|.::..|.   |..|:.:|..:|:|||::...|.|
  Fly   465 SCVNGLPVTDIRVKAGE--WELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEF 527

  Fly   129 SSTIKAIGLASSNPANGAAASVSGW----------GTLSYGSSSIPSQLQYVNVNIVSQSQCASS 183
            :|.|:.|.::..:|.:......|||          |.|.:.:.::|.          ::|:|::.
  Fly   528 ASHIQPICISDEDPKDSEQCFTSGWGKQALSIHEEGALMHVTDTLPQ----------ARSECSAD 582

  Fly   184 TYGYGSQIRSTMICAAASGKDACQGDSGGPLVSG--------GVLVGVVSWGYG 229
                     |:.:|:|.. .|:||.|.|..|..|        |:..|..|.|.|
  Fly   583 ---------SSSVCSATK-FDSCQFDVGSALACGSGSSVRLKGIFAGENSCGEG 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 53/227 (23%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 49/217 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.