DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and KLK3

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:242 Identity:75/242 - (30%)
Similarity:114/242 - (47%) Gaps:18/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAG 86
            |..|.:..|||||......|.|||:.:...|...|||.:.....::|||||:::.|. :|..|..
Human    16 GAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSV-ILLGRHS 79

  Fly    87 SSYWSSGGVTFSVSSFKNHEGYNANTMVN-----------DIAIIKINGALTFSSTIKAIGLASS 140
            ..:....|..|.||....|..|:.:.:.|           |:.:::::.....:..:|.:.|.:.
Human    80 LFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQ 144

  Fly   141 NPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGK 203
            .||.|.....||||::.......|.:||.|:::::|...||..   :..::...|:||.  ..||
Human   145 EPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQV---HPQKVTKFMLCAGRWTGGK 206

  Fly   204 DACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
            ..|.||||||||..|||.|:.||| ..||....|.:|..|...|.|:
Human   207 STCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/232 (31%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.