DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss21

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:274 Identity:86/274 - (31%)
Similarity:125/274 - (45%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQ-------- 74
            |:|        .|||||....:..:|||.||:..|:|.||.::.:...::|||||.|        
  Rat    53 TIP--------SRIVGGEEAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDW 109

  Fly    75 SVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV--------------NDIAIIKINGA 125
            :|....|..|  .|.|             |.:.|:....:              :|||::|::..
  Rat   110 TVQFGELTSR--PSLW-------------NLQAYSNRYQIEDIFLSPKYTEQFPHDIALLKLSSP 159

  Fly   126 LTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSS-SIPSQLQYVNVNIVSQSQC--ASSTY 185
            :|:|:.|:.|.|.:|..  ||.....|:|||.:....| .:|:.||.|.|.|::.:.|  .....
  Rat   160 VTYSNFIQPICLLNSTYKFANRTDCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMCNHLFKKP 224

  Fly   186 GYGSQIRSTMICAAA--SGKDAC---------QGDSGGPLVSG----GVLVGVVSWGYGCAYSNY 235
            .:...|...|:||.:  .|||||         |||||||||..    ...|||||||.||...|.
  Rat   225 DFRINIWGDMVCAGSPEGGKDACFAKLTYAAPQGDSGGPLVCNQDTVWYQVGVVSWGIGCGRPNR 289

  Fly   236 PGVYADVAALRSWV 249
            ||||.:::...:|:
  Rat   290 PGVYTNISHHYNWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/260 (32%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 83/260 (32%)
Tryp_SPc 58..304 CDD:238113 83/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.