DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and SPH93

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:229 Identity:62/229 - (27%)
Similarity:111/229 - (48%) Gaps:20/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTF-----SV 99
            :.:||.:::..:|.:..|||:...||::|.||.:.::... |.:|||.....|....|     .|
  Fly   255 AQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETE-LVVRAGDWDLKSDREIFLSEQREV 318

  Fly   100 SSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA-NGAAASVSGWGTLSYGSSSI 163
            .....|||::..:..|::|::.:|.....:..|:.|.|.:.|.: .|...:|:|||.:.|.....
  Fly   319 ERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRY 383

  Fly   164 PSQLQYVNVNIVSQSQC----ASSTYGYGSQIRSTMICAAAS-GKDACQGDSGGPLV------SG 217
            .:.|:.|.:.:|:::.|    .|:..|...::...:|||... |:|.|.||.|..|.      :.
  Fly   384 STVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENS 448

  Fly   218 GVL--VGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||.  .|:|:||.||.....|.:|.:|:...:|:
  Fly   449 GVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 61/227 (27%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 62/229 (27%)
Tryp_SPc 252..482 CDD:214473 61/227 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.