DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Send2

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:250 Identity:101/250 - (40%)
Similarity:144/250 - (57%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTV-PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIV 67
            |::||:..:.:.|..: ||       .||:||....|...|||:|:||.|.|.|||||||:::|:
  Fly     6 FLLLLALNSLSAGPVIRPE-------ERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIII 63

  Fly    68 TAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTI 132
            |||||:|...   .|:||||:..:|.|....|::.:.|||     :.|||||::::..|.|::.:
  Fly    64 TAAHCVQGQG---YQVRAGSALKNSNGSVVDVAAIRTHEG-----LGNDIAIVRLSKPLEFTNQV 120

  Fly   133 KAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMIC 197
            :.|.||.:||..|:.|.|||||:.||.|.  |..||.||:.|.....|..:        ..:.||
  Fly   121 QPIPLAKTNPPPGSIAFVSGWGSSSYYSH--PIDLQGVNLYIQWPYYCGLT--------EPSRIC 175

  Fly   198 AAASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWVIS 251
            |.:.|:.||:||||||||....||||||.| ..|.||:   :|..|...|.|:::
  Fly   176 AGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSS---IYTSVPYFREWILN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 94/219 (43%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 94/219 (43%)
Tryp_SPc 27..225 CDD:238113 93/218 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.