DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Phae1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:260 Identity:97/260 - (37%)
Similarity:138/260 - (53%) Gaps:21/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGT---VPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIV 67
            :||....|.:.|.   .||       ||:||||...::|.|:.:|:|..|:|.|..||.::|.:|
  Fly    15 LLLLLGICRISGVAIGAPE-------GRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLV 72

  Fly    68 TAAHCLQSVSASVL--QIRAGS---SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALT 127
            ||||||.: |..||  .:.|||   ...:|...|.|::.|..::.|...|:..||.:|....|..
  Fly    73 TAAHCLTN-SNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFV 136

  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQY-VNVNIVSQSQCASSTYGYGSQ 190
            :|:.:..:.|.||.......|::.||| |.:..::|.||.||. .||.|:|.|.|.|:....||.
  Fly   137 WSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSD 201

  Fly   191 IRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWVISN 252
            :.||.:|..  ..|...|..|||||||.|.||:|:|||| ..|..:|.|.||..|::..||:.:|
  Fly   202 VHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWISAN 266

  Fly   253  252
              Fly   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 88/228 (39%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 88/228 (39%)
Tryp_SPc 36..266 CDD:238113 88/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.