DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TMPRSS7

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:244 Identity:85/244 - (34%)
Similarity:120/244 - (49%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSS-- 92
            ||:||:.|....:|||:||...||..||.|:.|...:::||||......|      ..:.|::  
Human   605 RIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLS------DPTPWTAHL 663

  Fly    93 -----GGVTFSVSSFKN---HEGYNANTMVNDIAIIKINGALTFSSTIK------AIGLASSNPA 143
                 |...| ||..:.   ||.||:.|...|||::::  ::.:..|:|      .|........
Human   664 GMYVQGNAKF-VSPVRRIVVHEYYNSQTFDYDIALLQL--SIAWPETLKQLIQPICIPPTGQRVR 725

  Fly   144 NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASGK-DAC 206
            :|....|:|||......:.....||...|.::.|:.|. ||||.   |.|.|:||. .||| |||
Human   726 SGEKCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLCV-STYGI---ITSRMLCAGIMSGKRDAC 786

  Fly   207 QGDSGGPL----VSGG--VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :|||||||    .|.|  :|.|:||||:|....|:||||..|:....|:
Human   787 KGDSGGPLSCRRKSDGKWILTGIVSWGHGSGRPNFPGVYTRVSNFVPWI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 84/242 (35%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.