DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CFI

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001362207.1 Gene:CFI / 3426 HGNCID:5394 Length:601 Species:Homo sapiens


Alignment Length:208 Identity:57/208 - (27%)
Similarity:82/208 - (39%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EGLLPQLD-----------GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQ 74
            :.|||:|.           .|||||....:...|||::::.:...:|||.......|:||||||:
Human   327 KSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLR 391

  Fly    75 SVSASVLQIRAGSSYWSSGGVTFSVSSFKN----HEGYNANTMVNDIAIIKINGALTFSSTIKAI 135
            :......||......|....:...|..:.:    ||.|||.|..||||:|::..    ....|..
Human   392 ASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKK----DGNKKDC 452

  Fly   136 GLASSNPA----------NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG---Y 187
            .|..|.||          ......|||||...  .:.....||:..|.::|.   .|..||   |
Human   453 ELPRSIPACVPWSPYLFQPNDTCIVSGWGREK--DNERVFSLQWGEVKLISN---CSKFYGNRFY 512

  Fly   188 GSQIRSTMICAAA 200
            ..::.....|:.|
Human   513 EKEMECADCCSVA 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 53/188 (28%)
CFINP_001362207.1 FIMAC 43..108 CDD:214493
SR 114..215 CDD:214555
LDLa 224..256 CDD:238060
Ldl_recept_a 257..293 CDD:365841
Tryp_SPc 348..>519 CDD:238113 50/179 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.