DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Try29F

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:107/250 - (42%)
Similarity:145/250 - (57%) Gaps:12/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAA 70
            |||  |..:||.||..   |:||||||||....|...|:|:||||| .|.||||:.:...::|||
  Fly    22 ILL--VNLSLGATVRR---PRLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLIAQGWVLTAA 80

  Fly    71 HCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI 135
            ||.:..:..:.::|.|||..|.||....:.....|..::|.|:..|.:::::......:.|...:
  Fly    81 HCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFV 145

  Fly   136 GLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA 198
            ||...:.  |:|....|||||. :..:....:.|:.|.|..|||:|| :..||....|...|:||
  Fly   146 GLPEQDADIADGTPVLVSGWGN-TQSAQETSAVLRSVTVPKVSQTQC-TEAYGNFGSITDRMLCA 208

  Fly   199 A--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            .  ..|||||||||||||.:.|||.||||||||||..||||||:.|:|:|.|:.|
  Fly   209 GLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 93/222 (42%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 93/222 (42%)
Tryp_SPc 42..264 CDD:238113 93/224 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.