DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Jon25Bi

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:273 Identity:91/273 - (33%)
Similarity:135/273 - (49%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTV----PEGLLP---QLDGRIVGGSATTISSFPWQISLQRSGSHS--C 56
            |..||:|..|:|.....||    |:. ||   :::||||.|........|:.:.|..||:..  |
  Fly     1 MKVFVVLALALAAVSAETVQQVHPKD-LPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWC 64

  Fly    57 GGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSS---FKNHEGYNANTMVNDIA 118
            ||||.:.:.::|||||..  .||.:.|..|:::.::...|.:|.|   .:||...|.|.  ||||
  Fly    65 GGSIIAHDWVLTAAHCTN--GASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNG--NDIA 125

  Fly   119 IIKINGALTFSSTIKAIGLASSNPA----NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQ 179
            :|: ...:.|...:..:.|.|.|..    :...|...|||..:.||.  |..::.|::.|:|.|:
  Fly   126 LIR-TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQ--PDWMECVDLQIISNSE 187

  Fly   180 CASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLV--SGGVLVGVVSW--GYGCAYSNYPGVYA 240
            |:.:   ||:|....:..:.:.||..|.||||||||  .||.||||.||  |.||. :..|..:.
  Fly   188 CSRT---YGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCT-AGLPSGFT 248

  Fly   241 DVAALRSWVISNA 253
            .|.....|:..|:
  Fly   249 RVTNQLDWIRDNS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 77/231 (33%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 77/231 (33%)
Tryp_SPc 37..260 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.