DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Send1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:248 Identity:104/248 - (41%)
Similarity:142/248 - (57%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAH 71
            ||.||...:...||..|.|  ..||:|||:..|:..|||:|||..|.|.|||||||..:|:||||
  Fly     8 LLLAVHLLISPVVPVLLEP--SERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAH 70

  Fly    72 CLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIG 136
            |::....|   ||||||...||||...|.::..|..::.:.|.||:|::|::..|:||.:|:.|.
  Fly    71 CIKEGERS---IRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIP 132

  Fly   137 LASSNPANGAAASVSGWGTLSYGSSSI-PSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA 200
            ||.::|...::|..:|||.   |:..| |.|||.|.:.|.....|...   ||:.:.:..|||..
  Fly   133 LAETDPPTSSSALATGWGR---GNFLIRPRQLQGVEILIRPLIVCKLK---YGNGVFNEDICAGR 191

  Fly   201 SGKDACQGDSGGPLVSGGVLVGVVS--WGYGCAYSNYPGVYADVAALRSWVIS 251
            .||..|.||||||||..|.|||:.|  ....|..|:   :||.||..|:|::|
  Fly   192 MGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 94/221 (43%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 94/221 (43%)
Tryp_SPc 30..239 CDD:238113 93/220 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443191
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.