DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG11912

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:130/283 - (45%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLS-AVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSIYSS 63
            |.:|.::.: |:|.....:||:...|  :|||:.|........|:.:||| .|.||.|.||:...
  Fly     1 MKQFAVIFALALASVSAISVPQPGFP--EGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDE 63

  Fly    64 NVIVTAAHCL-----QSVSAS-------VLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVND 116
            ..||||||||     |:|:.:       .:|||           .|:.:.:..||.|......||
  Fly    64 VTIVTAAHCLTYNQGQAVAGAHSRTDQENVQIR-----------KFTNAQYVIHENYGGGVGPND 117

  Fly   117 IAIIKINGALTF---------SSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNV 172
            |.:|.:.....|         |:.:.|:.|.|......:...:.|||  ...|..:|..||.::.
  Fly   118 IGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWG--RDNSGLLPLNLQKLDA 180

  Fly   173 NIVSQSQCASSTYGYGSQIRSTMICAAASGK--DACQGDSGGPLVS-----GGVLVGVVSWGY-G 229
            .||..::|.::.....| :..|.:|....||  .:|.|||||||||     |..|:|:||||| .
  Fly   181 IIVDYNECKAALPSNNS-LAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTP 244

  Fly   230 CAYSNYPGVYADVAALRSWVISN 252
            |..:.||.||..|::...|:..|
  Fly   245 CLSTTYPSVYTSVSSFLPWIDEN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 78/248 (31%)
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 78/248 (31%)
Tryp_SPc 30..267 CDD:238113 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.