DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG1304

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:262 Identity:92/262 - (35%)
Similarity:138/262 - (52%) Gaps:18/262 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLP-QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            :|..|||.:....|  .||....| .|:||:|||.....:.||.|:||:.:|||||||||.|.|.
  Fly     4 VKAAILLGSFLLLL--AVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNY 66

  Fly    66 IVTAAHCLQS---------VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIK 121
            ::|||||:.:         ::|....|||||:...||||...|:....||.|  ...:||:|:::
  Fly    67 VLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLR 129

  Fly   122 INGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            :...|..|::|:.|.|.:::........:||||.:.: ...:|..|||..:..:|..:| ....|
  Fly   130 LESPLILSASIQPIDLPTADTPADVDVIISGWGRIKH-QGDLPRYLQYNTLKSISLERC-DELIG 192

  Fly   187 YGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            :|.|....:|..|.:|  ||.||||||.|....:|||..:.:....::||..||.|.....|:.:
  Fly   193 WGVQSELCLIHEADNG--ACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255

  Fly   252 NA 253
            |:
  Fly   256 NS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/227 (35%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 80/227 (35%)
Tryp_SPc 32..256 CDD:238113 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.