DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010243

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_554157.3 Gene:AgaP_AGAP010243 / 3292148 VectorBaseID:AGAP010243 Length:275 Species:Anopheles gambiae


Alignment Length:227 Identity:83/227 - (36%)
Similarity:126/227 - (55%) Gaps:11/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGV 95
            ||||....|...|:|:|::....|.|||||.::..::||.||:....|:.:.:|.||::::.||.
Mosquito    47 IVGGHVVDIEMHPYQVSVRELNEHICGGSIITNRWVLTAGHCVDDTIAAYMNVRVGSAFYAKGGT 111

  Fly    96 TFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLA--SSNPANGAAASVSGWG-TLS 157
            ...|.|...|..:...:.:.|.|::::..|:.||:..:.|.||  ..|..:.....|:||| ||:
Mosquito   112 IHPVDSVTTHPDHVPYSWLADFALLQLKHAIVFSTIAQPIALAFRLDNALSDRECVVTGWGRTLN 176

  Fly   158 YGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA---AASGKDACQGDSGGPLVSGGV 219
            ...|.  .:|:.|.:.:||:..|.::   |..:|..|||||   ...||.:|..|||||||.|.:
Mosquito   177 EEESF--DKLRAVQIPLVSRVLCNAT---YEGKIDQTMICAGDFVDGGKGSCAYDSGGPLVCGDM 236

  Fly   220 LVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            .||:||||.|||...||.||:.|...|:|:.|
Mosquito   237 QVGIVSWGKGCAMPGYPDVYSSVLYARAWINS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/223 (36%)
AgaP_AGAP010243XP_554157.3 Tryp_SPc 47..269 CDD:238113 83/227 (37%)
Tryp_SPc 47..266 CDD:214473 81/223 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.