DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:272 Identity:82/272 - (30%)
Similarity:124/272 - (45%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLD------GRIVGGSATTISSFPWQISLQRSGSHSCGGS 59
            :|:.|.||:.|..|:...:......|.:      ..||||....|...|:|.::...|...||||
Mosquito     3 VLRQVGLLAVVLAAISLPISSAQQQQEERDDSATNMIVGGMKVDIEQVPYQAAILTLGQVHCGGS 67

  Fly    60 IYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG-----------VTFSVSSFKNHEGYNANTM 113
            |.....::||.||:..:..:..::..||:....|.           .|.|..:|           
Mosquito    68 IIGPRWVLTAYHCVDWLLPNFYEVAVGSTNPYEGQRILVQELFVPLETLSDPNF----------- 121

  Fly   114 VNDIAIIKINGALTFSSTIKAIGLASSNPA--NGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIV 175
              |||:.|:...|.:|||::.|.|.:|:.:  ....|.:||:| |....|.:|   |:...:.::
Mosquito   122 --DIALAKLAHTLQYSSTVQCIPLLTSDSSLIPDTPAYISGFGYTKERASDNI---LKAAQIKVL 181

  Fly   176 SQSQCASSTYGYGSQIRSTMICAA-ASGK-DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGV 238
            ....|..:   |...:|..|:||. ..|| |:|||||||||:....|.|||.:|.|||..::|||
Mosquito   182 PWDYCQQA---YPYLMREFMLCAGFKEGKVDSCQGDSGGPLIVNAKLAGVVFYGEGCARPHFPGV 243

  Fly   239 YADVAALRSWVI 250
            |..|.....|:|
Mosquito   244 YISVPWFSDWII 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/234 (31%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 75/236 (32%)
Tryp_SPc 39..254 CDD:214473 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.