DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:226 Identity:69/226 - (30%)
Similarity:118/226 - (52%) Gaps:4/226 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRS-GSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS 91
            :||||||........||.:||:.| ..|.|||::.|:..::::|:||....|:.....|||.:.:
Mosquito    21 NGRIVGGIDAVAGDAPWMVSLRNSINQHLCGGTLLSNRFVLSSANCLSGRLATATMAVAGSRFLN 85

  Fly    92 SGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTL 156
            :..:.:.......|..:|.||:.:|:|:.:.......:.:::.:.|::.....|..|.|.|||. 
Mosquito    86 TAAIPYYGIQIITHPNFNVNTLEHDVALFQTALQFILTQSVQPLPLSADVIGVGVRARVFGWGA- 149

  Fly   157 SYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVSGGVL 220
            |..:....:.||::|||.:|...||:.....|.:|..:.:|. ...|:..|.||.||.||.....
Mosquito   150 SQANGGNTNALQFLNVNTLSNDDCANFLGAEGWRIGPSSLCTLTREGQGICGGDEGGALVLDNYA 214

  Fly   221 VGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            :||.|||..|| :..|.|:..::|:|||:::
Mosquito   215 IGVASWGIPCA-TGRPDVFVRISAVRSWILN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 67/220 (30%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 67/220 (30%)
Tryp_SPc 24..242 CDD:238113 66/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.