DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010663

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_559166.1 Gene:AgaP_AGAP010663 / 3291136 VectorBaseID:AGAP010663 Length:161 Species:Anopheles gambiae


Alignment Length:167 Identity:56/167 - (33%)
Similarity:81/167 - (48%) Gaps:11/167 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VIVTAAHCLQSVSASVLQIR--AGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALT 127
            :::|....:::..:..|||.  .||:..|.||:.|..|....|..:|..|...|.|||::..:..
Mosquito     1 LLLTVYTSIRTFLSLPLQITLYGGSASLSKGGIVFYASKIVIHPLFNVETADYDAAIIQVKNSFQ 65

  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            ....|..|.|.::...:.....|:|||   |...:.|..|||..:..:||.||:.:.:|..:   
Mosquito    66 GYKKIARIPLQNAEVPSNTLCCVAGWG---YNGQTYPDNLQYAALLAISQRQCSEAWFGLTT--- 124

  Fly   193 STMICAAASGK--DACQGDSGGPLVSGGVLVGVVSWG 227
            ...|| |..||  |.|.||||||||..|.|.||.|:|
Mosquito   125 PENIC-AQRGKNGDLCTGDSGGPLVCNGKLTGVTSYG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 56/167 (34%)
AgaP_AGAP010663XP_559166.1 Tryp_SPc 14..160 CDD:304450 54/152 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.