DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP004567

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_313871.5 Gene:AgaP_AGAP004567 / 3291034 VectorBaseID:AGAP004567 Length:321 Species:Anopheles gambiae


Alignment Length:257 Identity:97/257 - (37%)
Similarity:128/257 - (49%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHC 72
            |...||..|.|         ..|||||.|..:..:||.:.|...|:..||||:.:...|||||||
Mosquito    71 LYLTACGRGKT---------SSRIVGGDAADVKEYPWIVMLLYRGAFYCGGSLINDRYIVTAAHC 126

  Fly    73 L-----QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTI 132
            :     |.:.|.:..:..|..      ||.::.....||.::.:|..||||::|:...:....:.
Mosquito   127 VLSFTPQQLLAKLYDVEHGEM------VTRAIVKLYGHERFSLDTFNNDIALVKLQQPVEAGGSF 185

  Fly   133 KAIGL-ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMI 196
            ..|.| .:.....|...:|.|||.|:.||.|  ..||...|.|:|..||..|:| ..|:|...|:
Mosquito   186 IPICLPVAGRSFAGQNGTVIGWGKLANGSLS--QGLQKAIVPIISNMQCRKSSY-RASRITDNML 247

  Fly   197 CA--AASGKDACQGDSGGPLVSGG----VLVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252
            ||  ...|:|||||||||||..|.    .|||:||||.|||..||||||..|....:|:.||
Mosquito   248 CAGYTEGGRDACQGDSGGPLNVGDSNFRELVGIVSWGEGCARPNYPGVYTRVTRYLNWIKSN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 89/230 (39%)
AgaP_AGAP004567XP_313871.5 Tryp_SPc 84..306 CDD:214473 89/230 (39%)
Tryp_SPc 85..309 CDD:238113 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.