DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP007262

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_564960.3 Gene:AgaP_AGAP007262 / 3290331 VectorBaseID:AGAP007262 Length:316 Species:Anopheles gambiae


Alignment Length:248 Identity:76/248 - (30%)
Similarity:121/248 - (48%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQ---RSGSHSCGGSIYSSNVIVTAAHCLQ-SVSASVLQIRAGSSYW 90
            |||.|.......||:|::|.   .||...||.||.:...::|||||:. .|.||. .:..|::..
Mosquito    65 RIVNGQEARPGQFPYQVALLGQFNSGVGLCGASIITQRYVLTAAHCVYIGVDAST-PVANGTAIL 128

  Fly    91 ----------SSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI---GLASSNP 142
                      |...:|||.|....|.||:...:.||||:::::..:.::..|:.|   |.:.:..
Mosquito   129 GAHNRMIEEPSQQRITFSASGVIGHPGYDLFDVRNDIAVVRLDEPILYTDRIQPIRLPGRSDTRT 193

  Fly   143 ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA-SGKDAC 206
            ..|...:|||:|..|..:..:...|.||...:::.:.|.::..|:...|....:|.:. .|:.||
Mosquito   194 FAGLMGTVSGYGVYSTANPGLSDVLNYVLNPVITNADCRAAWSGFEWLIEPQNVCQSGDGGRSAC 258

  Fly   207 QGDSGGPLV---SGGVL-VGVVSWGY--GCAYSNYPGVYADVAALRSWVISNA 253
            ..||||||.   :|..| |||||:|.  ||. :..|.|:|.|.....|:.:|:
Mosquito   259 NSDSGGPLTVQDNGESLQVGVVSFGSAGGCD-NGIPTVFARVTYYLDWIEANS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/242 (31%)
AgaP_AGAP007262XP_564960.3 Tryp_SPc 65..306 CDD:214473 74/242 (31%)
Tryp_SPc 66..309 CDD:238113 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.