DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP005663

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_556312.2 Gene:AgaP_AGAP005663 / 3290018 VectorBaseID:AGAP005663 Length:317 Species:Anopheles gambiae


Alignment Length:249 Identity:74/249 - (29%)
Similarity:132/249 - (53%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQ---RSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS 91
            ||..|...|...||:||:|.   .:|:..||||:.::|.|:|||||:  :|.:.....:|::...
Mosquito    72 RITNGQEATPGQFPYQIALLSNFATGTGLCGGSVLTNNYILTAAHCV--ISGATTLATSGTAIMG 134

  Fly    92 SGG----------VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI---GLASSNPA 143
            :..          :.|:.:..:.|.|||...:.||||::::|..:||::.|:.|   |.:.|...
Mosquito   135 AHNRNVNEPTQQRIGFTSAGIRAHPGYNPTNIRNDIAVVRLNSPITFTARIQPIRLPGRSDSRQF 199

  Fly   144 NGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCAS--STYGYGSQIRSTMICAAA-SGKD 204
            .|...:|||:| |.:.|::|  ..:.:.:..:::.:.|.:  :|    :.|:...:|.:. .|:.
Mosquito   200 GGFTGTVSGFGRTTNTGATS--PVVMFTSNPVMTNADCIARWNT----ALIQPQNVCLSGDGGRS 258

  Fly   205 ACQGDSGGPLV---SGGVLVGVVSWG--YGCAYSNYPGVYADVAALRSWVISNA 253
            :|.|||||||.   .|.:.:|:||:|  .||:. ..|.|||.|:....|:.:|:
Mosquito   259 SCNGDSGGPLTVQDGGSLQIGIVSFGSAAGCSI-GMPSVYARVSFYLDWIDANS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/243 (30%)
AgaP_AGAP005663XP_556312.2 Tryp_SPc 72..307 CDD:214473 72/243 (30%)
Tryp_SPc 73..310 CDD:238113 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.