DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and psh

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:253 Identity:70/253 - (27%)
Similarity:117/253 - (46%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQIS---LQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS 87
            ||...||||.......:|...:   :.......||||:.:|..::|||||:.:.:.:...:|.|:
  Fly   139 QLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGA 203

  Fly    88 --------SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIK--AIGLASSNP 142
                    ||..     ..:.|.|.|..|..| ..|||||:::...:..:..|:  .:...:::|
  Fly   204 VNIENPDHSYQD-----IVIRSVKIHPQYVGN-KYNDIAILELERDVVETDNIRPACLHTDATDP 262

  Fly   143 ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR-------STMICAAA 200
            .:.:...|:|||.|:..:.:....|....:.:|...||..|.......||       .:::||..
  Fly   263 PSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAID 327

  Fly   201 SG--KDACQGDSGGPL-----VSGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ..  .|||:|||||||     |..|:  ::||:|.|:||| :..||:|..|::...::
  Fly   328 QKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCA-TVTPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 68/247 (28%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 68/247 (28%)
Tryp_SPc 144..387 CDD:238113 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.