DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Hayan

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:255 Identity:73/255 - (28%)
Similarity:122/255 - (47%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASV 80
            |..|..|:.|.:       :|...:||       .|.:..||||:.:|..::|||||:.|..::.
  Fly   388 GERVDRGVYPHM-------AAIAYNSF-------GSAAFRCGGSLIASRFVLTAAHCVNSDDSTP 438

  Fly    81 LQIRAGSSYWSS---GGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLAS--S 140
            ..:|.|:....:   |....:|...:.|..|:.::...||||:::......|..|:...|.:  |
  Fly   439 SFVRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRS 503

  Fly   141 NPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR-------STMICA 198
            :|.......|:|||.::..:.::...|....:::|...:|.:|.....|..|       ::.:||
  Fly   504 DPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCA 568

  Fly   199 AASG--KDACQGDSGGPL------VSGGV-LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |...  ||||||||||||      |.|.. :|||:|.|:||| :..||:|..|::...::
  Fly   569 ADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCA-TKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 69/239 (29%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 73/253 (29%)
Tryp_SPc 385..630 CDD:238113 73/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.