DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG9676

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:262 Identity:106/262 - (40%)
Similarity:143/262 - (54%) Gaps:22/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDG----RIVGGSATTISSFPWQISLQRSGSHSCGGSIY 61
            ||.|...| .|.||      .|:|.|.|.    |||||:......||.||||:|.|||:|||||.
  Fly     1 MLPFWTSL-LVLCA------AGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSII 58

  Fly    62 SSNVIVTAAHCLQS----VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKI 122
            |.:.:||||||::.    ..|:.|:|:|||...|||||...|::...|..||:|.  :|:|::::
  Fly    59 SKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRL 121

  Fly   123 NGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            ..:|||:|.|.||.||:.:|.|.|...:||||.:|. ...|.:.|.||.|..:|:..|..:   |
  Fly   122 RNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQ-RGPISNSLLYVQVKALSRESCQKT---Y 182

  Fly   188 GSQIRSTMICAA-ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            ..|:..|.:|.. ...|.||.||||||....|.|||:.|:..|......|..|..|:.||:|:..
  Fly   183 LRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247

  Fly   252 NA 253
            .|
  Fly   248 KA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 93/223 (42%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 93/223 (42%)
Tryp_SPc 28..248 CDD:238113 93/225 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.