DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG8952

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:267 Identity:79/267 - (29%)
Similarity:128/267 - (47%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLP-QLDGRIVGGSATTISSFPWQISLQRSGSHS--CGGSIYSSNVI 66
            ::||:|::.......|....| ::|.|||.||...:..||||:.|:|.....  |||||.|...:
  Fly    11 LVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWV 75

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            :|||||...:| |:..:......:::..:..:.::...|..|| :.:.||:::|::...||||:.
  Fly    76 LTAAHCTNGLS-SIFLMFGTVDLFNANALNMTSNNIIIHPDYN-DKLNNDVSLIQLPEPLTFSAN 138

  Fly   132 IKAIGL----ASSNPANGAAASVSGWG-----TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            |:||.|    ..|....|:.|:::|:|     .|.|..:     |.|..|.|:..:.|. :.||.
  Fly   139 IQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSET-----LLYAQVEIIDNADCV-AIYGK 197

  Fly   188 GSQIRSTMICAAASGKD--ACQGDSGGPL------VSGGVLVGVVSW--GYGCAYSNYPGVYADV 242
            ...:.|||......|.|  .|.|||||||      :.....:|:.|:  ...|.| ..|..||.|
  Fly   198 YVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTY-RLPSGYARV 261

  Fly   243 AALRSWV 249
            ::...::
  Fly   262 SSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/239 (31%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 73/239 (31%)
Tryp_SPc 38..271 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.