DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and HPN

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:242 Identity:90/242 - (37%)
Similarity:131/242 - (54%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL--QSVSASVLQIRAGS-SYWS 91
            |||||..|::..:|||:||:..|:|.||||:.|.:.::|||||.  ::...|..::.||: :..|
Human   162 RIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQAS 226

  Fly    92 SGGVTFSVSSFKNHEGY------NANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA--NGAAA 148
            ..|:...|.:...|.||      |:....||||::.::..|..:..|:.:.|.::..|  :|...
Human   227 PHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKIC 291

  Fly   149 SVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDS 210
            :|:||| |..||..:  ..||...|.|:|...|..:.: ||:||:..|.||.  ..|.|||||||
Human   292 TVTGWGNTQYYGQQA--GVLQEARVPIISNDVCNGADF-YGNQIKPKMFCAGYPEGGIDACQGDS 353

  Fly   211 GGPLVSGGV--------LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |||.|....        |.|:||||.|||.:..||||..|:..|.|:
Human   354 GGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 89/240 (37%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275
Tryp_SPc 163..400 CDD:238113 88/239 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.