DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and plg

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_958880.2 Gene:plg / 322691 ZFINID:ZDB-GENE-030131-1411 Length:818 Species:Danio rerio


Alignment Length:259 Identity:85/259 - (32%)
Similarity:121/259 - (46%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS-HSCGGSIYSSNVIVTAAHCL 73
            ::.|....|.|:    :..||||||..:...|:||||||:..|. |.|||::.....:|||||||
Zfish   572 SLKCGQPATKPK----RCFGRIVGGCVSKPHSWPWQISLRTRGKIHFCGGTLIDPQWVVTAAHCL 632

  Fly    74 Q-SVSASVLQI-------RAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSS 130
            : |.|.|..:|       ||..|......||   ...|...|       .|||::|::.....:.
Zfish   633 ERSDSPSAYKIMLGIHTERATESSKQERDVT---KIIKGPAG-------TDIALLKLDRPALIND 687

  Fly   131 TIKAIGLASSN---PANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            .:..:.|...:   |:| ....|:||| |...|..   ..|:.....::....|...::..| ::
Zfish   688 KVSPVCLPEKDYIVPSN-TECYVTGWGETQDTGGE---GYLKETGFPVIENKVCNRPSFLNG-RV 747

  Fly   192 RSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :...:||.  ..|.|:||||||||||    :..||.||.|||.|||.:..||||..|:....|:
Zfish   748 KDHEMCAGNIEGGNDSCQGDSGGPLVCYAQNTFVLQGVTSWGLGCANAMKPGVYTRVSKFVDWI 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/237 (34%)
plgNP_958880.2 PAN_AP_HGF 31..104 CDD:238532
KR 109..190 CDD:214527
KR 190..270 CDD:214527
KR 281..361 CDD:214527
Kringle 376..453 CDD:306546
KR 490..572 CDD:214527 85/259 (33%)
Tryp_SPc 589..813 CDD:238113 80/238 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.