DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG31269

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:253 Identity:84/253 - (33%)
Similarity:132/253 - (52%) Gaps:22/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR-SGSHSCGGSIYSSNVIVTAA 70
            |:|..|..:.|...:|...: |.||:||.|......|:|||||. ||:|||||:|.:...::|||
  Fly    15 LVSITAIRIKGNSTDGRFYK-DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAA 78

  Fly    71 HCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI 135
            ||:::.....|.:..|::.::..|..:.:.:...|..|:...|.||||::::...:.:....:.|
  Fly    79 HCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPI 143

  Fly   136 GLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCAS-------STYGYGSQIR 192
            .|.......|....::||| |:.:|:|  |..||.:.:..|...:|.:       ...|:     
  Fly   144 PLPLVPMQPGDEVILTGWGSTVLWGTS--PIDLQVLYLQYVPHRECKALLSNDEDCDVGH----- 201

  Fly   193 STMICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
               ||. :..|:.||.|||||||||.|.|||:|:||:.|| :..|.|:|.|...|.|:
  Fly   202 ---ICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 77/228 (34%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/228 (34%)
Tryp_SPc 38..258 CDD:238113 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.