DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG32834

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:261 Identity:82/261 - (31%)
Similarity:129/261 - (49%) Gaps:23/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68
            |:.||:|:...:.|.:      ....||:||....|...|:|..:...|:..|.|:|.:|:.|:|
  Fly     6 FLFLLAALLRPVRGDL------DAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIIT 64

  Fly    69 AAHCLQSVSASVLQIRAGSSY--WSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            ||.|:||..:  :::|.|:|.  :...|....|....||..||.....|::|::|:...|..|..
  Fly    65 AASCVQSYGS--IEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEA 127

  Fly   132 IKAIGLASSNPANGAAASVSGWGTLSYGSS-------SIPSQLQYVNVNIVSQSQCASST---YG 186
            |:.|.:|...|.:|:..:|||||:.|:..|       |:|..||...|::.::.|||:..   :|
  Fly   128 IQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFG 192

  Fly   187 YGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            ......|.:.....:|...|..|:|.|||..|.|||::|.| ||  :..|.|||:|.....|:..
  Fly   193 LWDNGISYLTLCTHNGAGGCSYDTGAPLVIDGQLVGILSEG-GC--TTKPDVYANVPWFTGWIAE 254

  Fly   252 N 252
            |
  Fly   255 N 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/230 (33%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 75/230 (33%)
Tryp_SPc 27..255 CDD:238113 75/232 (32%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.