DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG32755

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:253 Identity:87/253 - (34%)
Similarity:130/253 - (51%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PEGLLPQLDGRIVGGSATTISSFPWQISLQRSG--------SHSCGGSIYSSNVIVTAAHCLQSV 76
            |..:||    :||||...||...|:|:|::|..        .|.|||::.|..|:.:|||| .::
  Fly    31 PFVILP----KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAI 90

  Fly    77 SASV-LQIRAGSSYWSSGGVT-----------FSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
            :.|| |..|....|....|.:           :.|.....|:.||.:|:.||||::.:||.:.:.
  Fly    91 NTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE 155

  Fly   130 ST-IKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRS 193
            |. ::||.||...|..|....:.|||.::....|  :.||...|.|:::..| ...|    ::.:
  Fly   156 SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKS--ASLQQAPVPILNKELC-QVIY----KLPA 213

  Fly   194 TMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :.:||.  ..|.|||||||||||:..|.|.|::|||.|||...|||||.:|:....|:
  Fly   214 SQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/241 (34%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/241 (34%)
Tryp_SPc 38..273 CDD:238113 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.