DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG32260

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:276 Identity:85/276 - (30%)
Similarity:128/276 - (46%) Gaps:58/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISL-------QRSGSHSCGGSIYSSNVIV 67
            :..|.:.|..        ..|:|||......::||..:|       :.:....||||:..|..::
  Fly   315 SATCGISGAT--------SNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVI 371

  Fly    68 TAAHCLQSVSASVLQIRAGSSYWS----SGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTF 128
            |:|||   ::..:..:|.|:...|    ||.:...:.....||.::.|::.||||:|::|.....
  Fly   372 TSAHC---INPMLTLVRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGAL 433

  Fly   129 SSTIKAIGLASS-----------NPANGAAASVSGWGTLSYGSSSIPSQ-LQYVNVNIVSQSQCA 181
            ...|..|.|..:           ||      .|:|||.:.:  ..:.|| |:...|.|||:..|.
  Fly   434 PGNISPICLPEAAKFMQQDFVGMNP------FVAGWGAVKH--QGVTSQVLRDAQVPIVSRHSCE 490

  Fly   182 SSTYGYGS-----QIRSTMICAAASGKDACQGDSGGPL----VSGGV----LVGVVSWGYGCAYS 233
            .|   |.|     |....::||.:|..|||||||||||    :.|.|    |:|:||:||.||..
  Fly   491 QS---YKSIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARP 552

  Fly   234 NYPGVYADVAALRSWV 249
            |:||||..||:...|:
  Fly   553 NFPGVYTRVASYVPWI 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 82/254 (32%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 82/254 (32%)
Tryp_SPc 328..571 CDD:238113 82/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.