DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss40

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001101679.1 Gene:Prss40 / 316318 RGDID:1561330 Length:376 Species:Rattus norvegicus


Alignment Length:255 Identity:78/255 - (30%)
Similarity:110/255 - (43%) Gaps:35/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQ-SVSASVLQIRAGSSY 89
            |..|:|.||.......:|||.||:..|.|.||..:...|.:.:||||.| |.:....||..|  |
  Rat    66 QFQGKIYGGQIAGAQRWPWQASLRLYGRHICGAVLIDKNWVASAAHCFQMSRNPGDYQIMLG--Y 128

  Fly    90 WSSGGVT-----FSVSSFKNHEGYNA-NTMVNDIAIIKINGALTFSSTIKAIGLASSN---PANG 145
            ......|     .||.....|:.||. ....:||.:::::.::.:||.|....:.:.|   |.. 
  Rat   129 TKLNSPTRYSRKMSVKKLIVHKDYNKFYPQGSDIVLLQLHSSVEYSSHILPACVPNKNITIPKE- 192

  Fly   146 AAASVSGWGTLSYG-SSSIPSQLQYVNVNIVSQSQC----------ASSTYGYGSQIRSTMICAA 199
            .|...||||.|... ...:|:.|....:.|:|...|          :|.||    .|...|:|||
  Rat   193 KACWTSGWGNLREDVRLPLPNDLYEAELIIMSNDDCKGFFPPPVPGSSKTY----YIYDDMVCAA 253

  Fly   200 --ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYS-NYPGVYADVAALRSWVISN 252
              :..|..|.||||||||    ....:||:.||...|... :.|.|:|.|:....|:..|
  Rat   254 DYSLTKSICSGDSGGPLVCLLEGSWYVVGLTSWSSSCEDPISSPSVFARVSYFDKWISDN 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/246 (30%)
Prss40NP_001101679.1 Tryp_SPc 70..310 CDD:214473 74/246 (30%)
Tryp_SPc 71..313 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.