DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss6

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:257 Identity:89/257 - (34%)
Similarity:130/257 - (50%) Gaps:38/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQS-- 75
            |.|.|.         ..|||||:.::...:|||.|||..|.|.|||::.:...::|||||.|.  
  Rat   568 CGLQGP---------SSRIVGGAMSSEGEWPWQASLQIRGRHICGGALIADRWVITAAHCFQEDS 623

  Fly    76 -VSASVLQIRAG----SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI 135
             .|..:..:..|    :|.| .|.|:|.||....|..:..::...|:|:::::..:.:|:|::.:
  Rat   624 MASPRLWTVFLGKMRQNSRW-PGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPV 687

  Fly   136 GLASSNPAN------GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST 194
            .|    ||.      |....::|||....|... .|.||.|:|.::.|..| :..|.|  |:...
  Rat   688 CL----PARSHFFEPGQHCWITGWGAQREGGPG-SSTLQKVDVQLIPQDLC-NEAYRY--QVTPR 744

  Fly   195 MICAA--ASGKDACQGDSGGPLV----SG-GVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |:||.  ...|||||||||||||    || ..|.|:||||.||...|:.|||..|..:.:|:
  Rat   745 MLCAGYRKGKKDACQGDSGGPLVCKEPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVVNWI 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 85/238 (36%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 85/238 (36%)
Tryp_SPc 577..809 CDD:238113 85/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.