DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG6048

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:284 Identity:82/284 - (28%)
Similarity:130/284 - (45%) Gaps:35/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTV------PEGLLPQLD---GRIVGGSATTISSFPWQISLQRS----- 51
            :|...:||..:...|.|..      .:.:.|:.:   |||:.|:..::.:...|:.::::     
  Fly     7 LLAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGY 71

  Fly    52 ---GSHSCGGSIYSSNVIVTAAHCLQS--------VSASVLQIRAGS--SYWSSGGVTFSVSS-F 102
               ..|.||||:.....::|||||...        |......:..|:  .|..:..:||::.. .
  Fly    72 FFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERI 136

  Fly   103 KNHEGYNANTMVNDIAIIKINGAL-TFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQ 166
            ...:.::.:|...|||::.:||.: |...||:.|.|.......|....|:|||....|  .:...
  Fly   137 MQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDG--YVSDI 199

  Fly   167 LQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA---ASGKDACQGDSGGPLVSGGVLVGVVSWGY 228
            |..|:|.::|:..|.:.: ..|..|:..||||.   ...||||.||||||||....|.||||||.
  Fly   200 LMTVDVPMISEEHCINDS-DLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWGI 263

  Fly   229 GCAYSNYPGVYADVAALRSWVISN 252
            .||....||||.:|:....|::.|
  Fly   264 QCALPRLPGVYTEVSYYYDWILQN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/241 (30%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.