DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG3795

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:213 Identity:65/213 - (30%)
Similarity:103/213 - (48%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SHSCGGSIYSSNVIVTAAHCL----QSVSASVLQIRAGSS---YWSSGGVTFSVSSFKNHEGY-N 109
            :|.|.|:|:|...|:|||||:    :.:.|..|.:.||:.   ..||............|..| .
  Fly    76 NHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKK 140

  Fly   110 ANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGT-LSYGSSSIPSQLQYVNVN 173
            ..:...||.:|.:...|:....:..|.|.:..|..||..|:.|||| :.:|  .:|.:....::.
  Fly   141 GKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFG--PLPDEAINGDMQ 203

  Fly   174 IVSQSQCASSTYGYGSQIRSTMICA---AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNY 235
            |:..:.| ....|:.:   :.|:||   ..|..|:|||||||||:...::.|:||:|.||...:.
  Fly   204 ILPDTFC-EKLLGWSN---AGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDS 264

  Fly   236 PGVYADVAALRSWVISNA 253
            .|:|.||...|.|:..|:
  Fly   265 AGIYTDVYHFRDWITENS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 63/207 (30%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 64/210 (30%)
Tryp_SPc 60..278 CDD:214473 63/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.