DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss3

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:256 Identity:91/256 - (35%)
Similarity:127/256 - (49%) Gaps:21/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            |:.|...||        |:......|||||:.::::.:|||:|||..|.|.||||:.:...||||
  Rat   199 VVTLKCSAC--------GMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGYHLCGGSVITPLWIVTA 255

  Fly    70 AHCLQSV---SASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            |||:..:   .:..:|:.. .|...|...:..|.....|..|....:.||||::|::..|||..|
  Rat   256 AHCVYDLYHPKSWTVQVGL-VSLMDSPVPSHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDET 319

  Fly   132 IKAIGLASS--NPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST 194
            |:.|.|.:|  |..:|.....||||....|:......|.:..|.::|...|..... ||..|..:
  Rat   320 IQPICLPNSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDV-YGGIISPS 383

  Fly   195 MICAA--ASGKDACQGDSGGPLVSG----GVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |:||.  ..|.|:||||||||||..    ..|||..|:|.|||..|.||||..:.:...|:
  Rat   384 MLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 85/229 (37%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 5/19 (26%)
Tryp_SPc 216..444 CDD:214473 85/229 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.