DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klk12

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:265 Identity:85/265 - (32%)
Similarity:129/265 - (48%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLD-GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            :|..|||  :.|.:|       |.|.| .:|..|.....:|.|||:.|.......|||.:.....
  Rat     1 MKLNILL--LLCVVG-------LSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKW 56

  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGV-------TFSVS------SFKNHEGYNANTMVNDI 117
            ::|||||     :....:|.|....|...:       |||::      :::|||        :|:
  Rat    57 VLTAAHC-----SGKYMVRLGEHSLSKLDLTEQLRLTTFSITHPSYHGAYQNHE--------HDL 108

  Fly   118 AIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCAS 182
            .::::|..::.:..::.:.|.||....||...:|||||.:......|.:||.::::|||...|.:
  Rat   109 RLLRLNRPISLTYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRA 173

  Fly   183 STYGYGSQIRSTMICAAA-SGKDACQGDSGGPLVSGGVLVGVVSWGY--GCAYSNYPGVYADVAA 244
            .   :..::...|:||.. :||||||||||||||.||||.|:||||.  .|.....||||..|..
  Rat   174 V---FPGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCK 235

  Fly   245 LRSWV 249
            ...|:
  Rat   236 YTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/234 (32%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.