DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and HABP2

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:268 Identity:84/268 - (31%)
Similarity:115/268 - (42%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TVPEGLLPQLDG------------RIVGGSATTISSFPWQISLQRS--------GSHSCGGSIYS 62
            |.|...||..|.            ||.||..:|....|||.|||.|        ..|.|||::..
Human   289 TEPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIH 353

  Fly    63 SNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGV---TFSVSSFKNHEGYNANTMV--NDIAIIK- 121
            ...::||||| ..:....|::..|.........   :|.|.....:..||....:  ||||::| 
Human   354 PCWVLTAAHC-TDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKL 417

  Fly   122 --INGALTFSST-IKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASS 183
              ::|.....|. :|.:.|...:..:|:...:||||....|..|  .||....|.:::.:.| :|
Human   418 KPVDGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGS--RQLLDAKVKLIANTLC-NS 479

  Fly   184 TYGYGSQIRSTMICAA---ASGKDACQGDSGGPLV---SGGVLV-GVVSWGYGCAYSNYPGVYAD 241
            ...|...|..:||||.   ..|:|.|||||||||.   .|...| |:||||..|  ...||||..
Human   480 RQLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLEC--GKRPGVYTQ 542

  Fly   242 VAALRSWV 249
            |....:|:
Human   543 VTKFLNWI 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 78/242 (32%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 78/243 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.