DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and GZMH

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:271 Identity:74/271 - (27%)
Similarity:110/271 - (40%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQI---SLQRSGSHSCGGSIYS 62
            |..|::||:.:.....||          ..|:||......|.|:..   .||......|||.:..
Human     1 MQPFLLLLAFLLTPGAGT----------EEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVR 55

  Fly    63 SNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKN---------------HEGYNANT 112
            .:.::|||||            .|||.    .||....:.|.               |..||...
Human    56 KDFVLTAAHC------------QGSSI----NVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKN 104

  Fly   113 MVNDIAIIKINGALTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIV 175
            ..|||.::::.....:::.::.:.|.||..  ..|...||:|||.:|  .|::.:.||.|.:.: 
Human   105 FSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVS--MSTLATTLQEVLLTV- 166

  Fly   176 SQSQCASSTYGYGSQIRSTMICAAASGK--DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGV 238
             |..|......:|:..|:|.||.....|  ...:||||||||...|..|::|  ||......|||
Human   167 -QKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILS--YGNKKGTPPGV 228

  Fly   239 YADVAALRSWV 249
            |..|:....|:
Human   229 YIKVSHFLPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 67/240 (28%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 68/241 (28%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.