DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Elane

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:241 Identity:77/241 - (31%)
Similarity:119/241 - (49%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSY 89
            |.|...||||......::|:.:||||.|.|.||.::.:.|.:::||||:...:...:|:..|:..
  Rat    27 PALASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCVNGRNFQSVQVVLGAHD 91

  Fly    90 WSSGGVT---FSVSS-FKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAAS- 149
            ......|   |||.. |:|  |::.:.::|||.||::||:.|.::.::...|    ||.|.... 
  Rat    92 LRRREPTRQIFSVQRIFEN--GFDPSRLLNDIVIIQLNGSATINANVQVAEL----PAQGQGVGN 150

  Fly   150 -----VSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDA--CQ 207
                 ..|||.|. .:..:||.||.:||.:|: :.|.          |...:|.....:.|  |.
  Rat   151 RTPCVAMGWGRLG-TNRPLPSVLQELNVTVVT-NLCR----------RRVNVCTLVPRRQAGICF 203

  Fly   208 GDSGGPLVSGGVLVGVVSW--GYGCAYSNYPGVYADVAALRSWVIS 251
            ||||||||...::.|:.|:  | ||....||..:|.||....|:.|
  Rat   204 GDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVAEFADWINS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/232 (31%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 73/232 (31%)
Tryp_SPc 33..249 CDD:238113 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.