DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klk1c8

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:261 Identity:79/261 - (30%)
Similarity:120/261 - (45%) Gaps:27/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            :||...::.......|.|     ..||:||.....:|.|||:::.......|||.:...:.::||
  Rat     4 LILFLILSLGWNDAAPPG-----QSRIIGGFNCEKNSQPWQVAVYHFNEPQCGGVLIHPSWVITA 63

  Fly    70 AHCLQSVSASV-------------LQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIK 121
            ||| .||:..|             .|.|..|..:...|  |::...|||.....|...||:.::.
  Rat    64 AHC-YSVNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPG--FNLDIIKNHTRKPGNDYSNDLMLLH 125

  Fly   122 INGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            :......:..:|.|.|.:..|..|:....||||:::......|..||.||::::|..:|..:   
  Rat   126 LKTPADITDGVKVIDLPTEEPKVGSTCLTSGWGSITPLKWEFPDDLQCVNIHLLSNEKCIKA--- 187

  Fly   187 YGSQIRSTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSW 248
            |..::...|:||..  .|||.|:|||||||:..|||.|:.||| ..|...|.|.||..:....||
  Rat   188 YNDEVTDVMLCAGEMDGGKDICKGDSGGPLICDGVLQGITSWGSMPCGEPNKPSVYTKLIKFTSW 252

  Fly   249 V 249
            :
  Rat   253 I 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/234 (32%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 74/234 (32%)
Tryp_SPc 25..256 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.