DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klk10

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:266 Identity:75/266 - (28%)
Similarity:116/266 - (43%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACAL-GGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAA 70
            |.:|.|..| |.|..|.|      ...|....::|. |||:||..:....|.|.:...|.::|||
  Rat    29 LWAAQALLLPGNTTREDL------EAFGTLCPSVSQ-PWQVSLFHNLQFQCAGVLVDQNWVLTAA 86

  Fly    71 HCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV-------------------ND 116
            ||.::   ..|:.|.|..:         :..|::.:..:.|:.|                   :|
  Rat    87 HCWRN---KPLRARVGDDH---------LLLFQSEQLRSTNSPVFHPKYQPCSGPVLPLRSDEHD 139

  Fly   117 IAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCA 181
            :.::|::..:..:|.:..:.|............||||||.:.........|....|.::||.|| 
  Rat   140 LMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRSLSCSRVTLLSQKQC- 203

  Fly   182 SSTYGYGSQIRSTMICAAAS-GKDACQGDSGGPLVSGGVLVGVVSWG-YGC-AYSNYPGVYADVA 243
             .|: |...|.:.||||... .:|:||.|||||||....|.|::||. |.| |.:.||.|||.:.
  Rat   204 -ETF-YPGVITNNMICAGMDRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAATQYPAVYAKIC 266

  Fly   244 ALRSWV 249
            ...:|:
  Rat   267 NYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 66/240 (28%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.