DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klk11

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:269 Identity:81/269 - (30%)
Similarity:128/269 - (47%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACAL-----GGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI 60
            :|:.:::|..:|.||     ||          :.||:.|......|.|||::|.:.....||.::
  Rat    26 LLQAMMILRFIALALVTGHVGG----------ETRIIKGYECRPHSQPWQVALFQKTRLLCGATL 80

  Fly    61 YSSNVIVTAAHCLQSVSASVL------------QIRAGSSYWSSGGVTFSVSSFKNHEGYNANTM 113
            .:...::|||||.:.....:|            |.|..:..:...|...|:.: |:|.       
  Rat    81 IAPKWLLTAAHCRKPHYVILLGEHNLEKTDGCEQRRMATESFPHPGFNNSLPN-KDHR------- 137

  Fly   114 VNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQS 178
             |||.::|::.....:..::.:.|:|.....|.:..:|||||.|.....:|..|:..||:|:...
  Rat   138 -NDIMLVKMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHK 201

  Fly   179 QCASSTYGYGSQIRSTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYA 240
            :|..:   |...|..||:||:.  .|||:||||||||||..|.|.|::|||.. ||.:..||||.
  Rat   202 ECERA---YPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYT 263

  Fly   241 DVAALRSWV 249
            .|.....|:
  Rat   264 KVCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/233 (31%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 73/233 (31%)
Tryp_SPc 51..275 CDD:238113 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.