DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Mcpt1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_058841.1 Gene:Mcpt1 / 29265 RGDID:3062 Length:247 Species:Rattus norvegicus


Alignment Length:242 Identity:63/242 - (26%)
Similarity:102/242 - (42%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQLDG--RIVGGSATTISSFPWQISL----QRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVL 81
            |||...|  .|:||..:...|.|:...|    :|....||||.:.:...::|||||    ....:
  Rat    11 LLPSGAGAEEIIGGVESIPHSRPYMAHLDIITERGLKDSCGGFLITRQFVLTAAHC----RGREI 71

  Fly    82 QIRAGSSYWSSGGVT---FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA 143
            .:..|:...|....|   ..|.....|:.||....::||.::|:...:..:..:..:.|.|  |:
  Rat    72 TVTLGAHDVSKREYTQQKIKVEKQFIHKNYNFLPNLHDIMLLKLEKQVELTPAVDVVPLPS--PS 134

  Fly   144 N----GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGK- 203
            :    |.....:|||.... .......|:.|.:.|:.:..|..    |.....:..:|...|.: 
  Rat   135 DFIHPGTLCWTAGWGRTGV-KDPTSDTLREVALRIMDEEACKI----YRHYDNNFQVCVGLSTRL 194

  Fly   204 -DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
             .|..|||||||:..||:.|:||:|:..|  ..|.|:..:|....|:
  Rat   195 QTAYTGDSGGPLLCAGVVHGIVSYGHPDA--TPPAVFTRIAPYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 58/231 (25%)
Mcpt1NP_058841.1 Tryp_SPc 20..239 CDD:214473 58/231 (25%)
Tryp_SPc 21..242 CDD:238113 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.